PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG003211.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family TALE
Protein Properties Length: 368aa    MW: 41026.1 Da    PI: 6.4032
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG003211.2genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092953302055
                  HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +k +yps++++  LA+++gL+++q+ +WF N+R ++
  CCG003211.2 295 HKWPYPSEAQKLALAESTGLDQKQINNWFINQRKRH 330
                  4569*****************************885 PP

2ELK38.42.7e-13250271122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLk+EF+
  CCG003211.2 250 ELKGQLLRKYSGYLGSLKKEFM 271
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.6E-19114158IPR005540KNOX1
PfamPF037905.9E-21116154IPR005540KNOX1
SMARTSM012569.2E-25163214IPR005541KNOX2
PfamPF037911.4E-20167213IPR005541KNOX2
PfamPF037892.4E-10250271IPR005539ELK domain
PROSITE profilePS5121311.034250270IPR005539ELK domain
SMARTSM011886.0E-8250271IPR005539ELK domain
PROSITE profilePS5007112.94270333IPR001356Homeobox domain
SuperFamilySSF466891.58E-19272347IPR009057Homeodomain-like
SMARTSM003893.8E-14272337IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.3E-28275335IPR009057Homeodomain-like
CDDcd000865.96E-13282334No hitNo description
PfamPF059201.4E-16290329IPR008422Homeobox KN domain
PROSITE patternPS000270308331IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MEGGGAGCSS TPSLMMAFGD SSDGLCSMMM MPLMSSSSSA HQHHHQQQHV NAGDSSISNT  60
LFLPLPATNY QSQNRINNSV SGSSMILDDH SHNNTVTATG CYFMENNDGG SSSTSVKAKI  120
MAHPHYHRLL AAYANCQKVG APPEVVARLE EACASAASMA PANTDGIGED PALDQFMEAY  180
CEMLTKYEQE LSKPLKEAMV FLQRVECQFR ALTLSSPNSA WGEGNDRNAS SEEEVDVNDK  240
FIDPQAEDQE LKGQLLRKYS GYLGSLKKEF MKKRKKGKLP KEARQQLLDW WSRHHKWPYP  300
SEAQKLALAE STGLDQKQIN NWFINQRKRH WKPSEDMQFV VMDAGHPHYY MDNVLGNPFP  360
MDISHTLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265274LKKEFMKKRK
2271275KKRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6849370.0AY684937.1 Populus balsamifera subsp. trichocarpa x Populus deltoides homeobox transcription factor KN2 (Kn2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046994.10.0PREDICTED: homeobox protein SBH1-like
SwissprotP466081e-156HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9N8F40.0B9N8F4_POPTR; Knox protein 1
STRINGVIT_10s0116g00190.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-132KNOX/ELK homeobox transcription factor